PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PK04961.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Cannabaceae; Cannabis
Family NAC
Protein Properties Length: 420aa    MW: 47363.3 Da    PI: 6.0759
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PK04961.1genomeCCBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM168.32.6e-52151431128
        NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvka...eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                +ppGfrFhPt+eel+++yLkkkv++++++l +vi++vd++k+ePwd+++++k     +++wyfFs++dkky+tg+r+nrat++g+Wkatg+dk ++s ++
  PK04961.1  15 VPPGFRFHPTEEELLQYYLKKKVSNQSIDL-DVIRDVDLNKLEPWDIQERCKIgttPQNDWYFFSHKDKKYPTGTRTNRATAAGFWKATGRDKVIYS-NS 112
                69****************************.9***************964444122455**************************************.99 PP

        NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                + +g++ktLvfykgrap+g k+dW+mheyrl
  PK04961.1 113 KRIGMRKTLVFYKGRAPHGLKSDWIMHEYRL 143
                99***************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019411.83E-589179IPR003441NAC domain
PROSITE profilePS5100556.6515179IPR003441NAC domain
PfamPF023656.5E-2816143IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009809Biological Processlignin biosynthetic process
GO:0009834Biological Processplant-type secondary cell wall biogenesis
GO:0009901Biological Processanther dehiscence
GO:0010047Biological Processfruit dehiscence
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 420 aa     Download sequence    Send to blast
MPDSMSISVN GQSQVPPGFR FHPTEEELLQ YYLKKKVSNQ SIDLDVIRDV DLNKLEPWDI  60
QERCKIGTTP QNDWYFFSHK DKKYPTGTRT NRATAAGFWK ATGRDKVIYS NSKRIGMRKT  120
LVFYKGRAPH GLKSDWIMHE YRLDDNTITT TNDIIITNNI HGENNSPEEG WVVCRIFKKK  180
NHHQKSSVDH QSTSSPVVNT VLMESTEEMT VFDSSSIGDE GALEQIFQYM GKSGTTCKEE  240
EAGTENDTND DTNDNSNNCR FLPINNDTTT SSLFLKLPSL ESPNSSQNGY HQPMNNNNNN  300
NGDIISPNFG FMNNHHQMML DSNLMIISNW ATLDRLVACQ LNGQTDQASM DYCTDNNQNH  360
HHHMQVPPVT TTTVRSSSSS NKPQAEYNNE IGLWSSTFAK SSSSSLLPSD PICHVSNASL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A4e-511518515174Stress-induced transcription factor NAC1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00321DAPTransfer from AT2G46770Download
Motif logo
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010100656.11e-152NAC domain-containing protein 43
SwissprotQ84WP61e-129NAC43_ARATH; NAC domain-containing protein 43
TrEMBLW9RNU11e-152W9RNU1_9R
STRINGGLYMA16G02200.21e-142(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF30313374
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G46770.11e-106NAC family protein